PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017915
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 306aa    MW: 35545.5 Da    PI: 6.6402
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017915genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81.1e-5371351128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eelv +yLk+k+++ k++l +vi ++d+yk+ePwd+++k++    e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+v+s 
  Lus10017915   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVIVDIDLYKMEPWDIQEKCNLgydEQSEWYFFSHKDRKYPTGTRTNRATSAGFWKATGRDKAVVS- 102
                  69****************************.99**************953333333667**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  k++ +g++ktLvfy+grap+g+k+dW+mheyrl
  Lus10017915 103 KNKIIGMRKTLVFYRGRAPNGRKSDWIMHEYRL 135
                  8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-604156IPR003441NAC domain
PROSITE profilePS5100558.3067156IPR003441NAC domain
PfamPF023651.6E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEMESCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIV DIDLYKMEPW DIQEKCNLGY  60
DEQSEWYFFS HKDRKYPTGT RTNRATSAGF WKATGRDKAV VSKNKIIGMR KTLVFYRGRA  120
PNGRKSDWIM HEYRLQNPQN EAPQEEGWVV CRAFKKPVPN QRPGFDHYHH HQQWNMQHSD  180
NHDYDHHQRP PSSSSETSST SYQLLPPHHI HHQHHEHQLI LSSTTSQPFM DINSQLMMTI  240
NNNNNIQLPQ LLDSPSTTTS HQNNNLEELF LVSSQEANIF SSLPMLDSES GAASASRFFE  300
CFPDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-51716217171NO APICAL MERISTEM PROTEIN
1ut4_B6e-51716217171NO APICAL MERISTEM PROTEIN
1ut7_A6e-51716217171NO APICAL MERISTEM PROTEIN
1ut7_B6e-51716217171NO APICAL MERISTEM PROTEIN
3swm_A9e-51716220174NAC domain-containing protein 19
3swm_B9e-51716220174NAC domain-containing protein 19
3swm_C9e-51716220174NAC domain-containing protein 19
3swm_D9e-51716220174NAC domain-containing protein 19
3swp_A9e-51716220174NAC domain-containing protein 19
3swp_B9e-51716220174NAC domain-containing protein 19
3swp_C9e-51716220174NAC domain-containing protein 19
3swp_D9e-51716220174NAC domain-containing protein 19
4dul_A6e-51716217171NAC domain-containing protein 19
4dul_B6e-51716217171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526818.11e-122PREDICTED: NAC domain-containing protein 30
SwissprotQ9C8W91e-107NAC30_ARATH; NAC domain-containing protein 30
TrEMBLB9SLE91e-122B9SLE9_RICCO; NAC domain-containing protein, putative
STRINGPOPTR_0019s11330.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.12e-96vascular related NAC-domain protein 7